PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00012.1.g09180.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 825aa    MW: 90981.4 Da    PI: 5.8671
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00012.1.g09180.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP111.84.2e-35187262176
                                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
                             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                                     +Cqv+gCead+ e+k yhrrh+vC  +++a++vl++g+++r+CqqC++fh l +fDe+krsCrr+L++hn+rrr+k
  Zjn_sc00012.1.g09180.1.sm.mkhc 187 RCQVPGCEADIRELKGYHRRHRVCLRCAHAAAVLLDGVQKRYCQQCGKFHVLLDFDEDKRSCRRKLERHNKRRRRK 262
                                     6************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.4E-27184249IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.615185262IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.01E-33186266IPR004333Transcription factor, SBP-box
PfamPF031108.8E-27188262IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055070Biological Processcopper ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 825 aa     Download sequence    Send to blast
MDAPYSGGGG VDAGEPVWDW GNLLDFVVQD DDSLVLPWDD VAGTGAAGPT EAGASLLATP  60
PPQPAEVEAN QEPEPEPEPE PVLPPLPLHV QGIGRRVRKR DPRLVCPNYL AGRVPCACPE  120
VDEMAAAAEV EDVATELLAG ARKKVKTAGR RGKAGAVGGA GGSGGGVSTT GGGSGGGGRA  180
VVAAEMRCQV PGCEADIREL KGYHRRHRVC LRCAHAAAVL LDGVQKRYCQ QCGKFHVLLD  240
FDEDKRSCRR KLERHNKRRR RKPDSKVPFE KEMDEHLDLS ADVSGDGELR EENIECTTSE  300
MLETVLSNKV LDRETPMGSE DVLSSPTCTQ PNLQNEQSKS IVTFAASVEA SSGAKQESVK  360
LNNSPIHDLK TAYSSSCPTG RISFKLYDWN PAEFPRRLRH QIFEWLASMP VELEGYIRPG  420
CTILTVFIAM PQHMWDKLSD DTANLLRNLV NCPNSLLLGK GNFFIHIDNM IFQVLKDGAT  480
LMSTRLEMQA PRIHYVHPTW FEAGKPVELF VCGSSLDQPK FRSLLSFDGN YLKHDCFRVA  540
SLDAFDCVEK DDLKLDSQHE MFRISISGSR PDTQGPAFVE VENMFGLSNF VPILFGSRQL  600
CSELAKIQDV LCGSCKNNDI FEEFPSASSD PCECKKVKSA AMSGFLIDIG WLIRKPSSEE  660
FKNVLSLTNI QRWVYMLKFL IQNDFLNVLE IIVKSMDNFI GSEILSNLEK GRLEDHVATF  720
LAYLNHAQSI VNQKAKHGEE TQLETRLVTD KFPKHQSLGT SVPLDKGKTT GLGGHNDLLL  780
TSAACEEEVT MPLMTKDATH RQCCHPDISA RWLKHSRVGP QEHDS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A1e-36187266584squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1244262KRSCRRKLERHNKRRRRKP
2248260RRKLERHNKRRRR
3255262NKRRRRKP
4256261KRRRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00604PBMTransfer from AT5G18830Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008656292.10.0PREDICTED: squamosa promoter-binding-like protein 9 isoform X1
SwissprotQ6I5760.0SPL9_ORYSJ; Squamosa promoter-binding-like protein 9
TrEMBLK7VFT10.0K7VFT1_MAIZE; Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein
STRINGGRMZM2G109354_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69223344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.21e-136squamosa promoter binding protein-like 7